CIAPIN1 monoclonal antibody (M01), clone 5G8
  • CIAPIN1 monoclonal antibody (M01), clone 5G8

CIAPIN1 monoclonal antibody (M01), clone 5G8

Ref: AB-H00057019-M01
CIAPIN1 monoclonal antibody (M01), clone 5G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.
Información adicional
Size 100 ug
Gene Name CIAPIN1
Gene Alias 2810413N20Rik|Anamorsin|DRE2|PRO0915
Gene Description cytokine induced apoptosis inhibitor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57019
Clone Number 5G8
Iso type IgG1 Lambda

Enviar un mensaje


CIAPIN1 monoclonal antibody (M01), clone 5G8

CIAPIN1 monoclonal antibody (M01), clone 5G8