Ver mas grande
CIAPIN1 monoclonal antibody (M01), clone 5G8
AB-H00057019-M01
Producto nuevo
CIAPIN1 monoclonal antibody (M01), clone 5G8
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | CIAPIN1 |
| Gene Alias | 2810413N20Rik|Anamorsin|DRE2|PRO0915 |
| Gene Description | cytokine induced apoptosis inhibitor 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 57019 |
| Clone Number | 5G8 |
| Iso type | IgG1 Lambda |
Más información
Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.