CIAPIN1 monoclonal antibody (M01), clone 5G8 View larger

Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.

AB-H00057019-M01

New product

CIAPIN1 monoclonal antibody (M01), clone 5G8

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CIAPIN1
Gene Alias 2810413N20Rik|Anamorsin|DRE2|PRO0915
Gene Description cytokine induced apoptosis inhibitor 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq DLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CIAPIN1 (NP_064709, 211 a.a. ~ 312 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 57019
Clone Number 5G8
Iso type IgG1 Lambda

More info

Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.

Mouse monoclonal antibody raised against a partial recombinant CIAPIN1.