VPS11 polyclonal antibody (A01) Ver mas grande

VPS11 polyclonal antibody (A01)

AB-H00055823-A01

Producto nuevo

VPS11 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name VPS11
Gene Alias END1|PEP5|RNF108|hVPS11
Gene Description vacuolar protein sorting 11 homolog (S. cerevisiae)
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VPS11 (NP_068375, 842 a.a. ~ 941 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 55823

Más información

Mouse polyclonal antibody raised against a partial recombinant VPS11.

Consulta sobre un producto

VPS11 polyclonal antibody (A01)

VPS11 polyclonal antibody (A01)