View larger
Mouse polyclonal antibody raised against a partial recombinant VPS11.
AB-H00055823-A01
New product
VPS11 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | VPS11 |
| Gene Alias | END1|PEP5|RNF108|hVPS11 |
| Gene Description | vacuolar protein sorting 11 homolog (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | FHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | VPS11 (NP_068375, 842 a.a. ~ 941 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 55823 |
More info
Mouse polyclonal antibody raised against a partial recombinant VPS11.