Ver mas grande
PI4KII monoclonal antibody (M01), clone 3E1
AB-H00055361-M01
Producto nuevo
PI4KII monoclonal antibody (M01), clone 3E1
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PI4K2A |
| Gene Alias | DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6 |
| Gene Description | phosphatidylinositol 4-kinase type 2 alpha |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA |
| Immunogen Prot. Seq | LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 55361 |
| Clone Number | 3E1 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PI4KII.