PI4KII monoclonal antibody (M01), clone 3E1 View larger

Mouse monoclonal antibody raised against a partial recombinant PI4KII.

AB-H00055361-M01

New product

PI4KII monoclonal antibody (M01), clone 3E1

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PI4K2A
Gene Alias DKFZp761G1923|PI4KII|PIK42A|RP11-548K23.6
Gene Description phosphatidylinositol 4-kinase type 2 alpha
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq LILPKISDPNFVKDLEEDLYELFKKDPGFDRGQFHKQIAVMRGQILNLTQALKDNKSPLHLVQMPPVIVETARSHQRSSSESYTQSFQSRKPFFS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PI4KII (NP_060895.1, 383 a.a. ~ 477 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 55361
Clone Number 3E1
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PI4KII.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PI4KII.

Mouse monoclonal antibody raised against a partial recombinant PI4KII.