CHST11 monoclonal antibody (M02), clone 1H3 Ver mas grande

CHST11 monoclonal antibody (M02), clone 1H3

AB-H00050515-M02

Producto nuevo

CHST11 monoclonal antibody (M02), clone 1H3

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name CHST11
Gene Alias C4ST|C4ST-1|C4ST1|HSA269537
Gene Description carbohydrate (chondroitin 4) sulfotransferase 11
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50515
Clone Number 1H3
Iso type IgG2a Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant CHST11.

Consulta sobre un producto

CHST11 monoclonal antibody (M02), clone 1H3

CHST11 monoclonal antibody (M02), clone 1H3