CHST11 monoclonal antibody (M02), clone 1H3 View larger

Mouse monoclonal antibody raised against a partial recombinant CHST11.

AB-H00050515-M02

New product

CHST11 monoclonal antibody (M02), clone 1H3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name CHST11
Gene Alias C4ST|C4ST-1|C4ST1|HSA269537
Gene Description carbohydrate (chondroitin 4) sulfotransferase 11
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVGSYLKFPTYAKSTRTTDEMTTEFFQNISSEHQTQLYEVYKLD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHST11 (NP_060883, 230 a.a. ~ 337 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 50515
Clone Number 1H3
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant CHST11.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant CHST11.

Mouse monoclonal antibody raised against a partial recombinant CHST11.