SNX12 monoclonal antibody (M01), clone 2C10
  • SNX12 monoclonal antibody (M01), clone 2C10

SNX12 monoclonal antibody (M01), clone 2C10

Ref: AB-H00029934-M01
SNX12 monoclonal antibody (M01), clone 2C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SNX12.
Información adicional
Size 100 ug
Gene Name SNX12
Gene Alias MGC118982|MGC118983
Gene Description sorting nexin 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SNX12 (AAH20559, 53 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 29934
Clone Number 2C10
Iso type IgG2a Kappa

Enviar un mensaje


SNX12 monoclonal antibody (M01), clone 2C10

SNX12 monoclonal antibody (M01), clone 2C10