View larger
Mouse monoclonal antibody raised against a partial recombinant SNX12.
AB-H00029934-M01
New product
SNX12 monoclonal antibody (M01), clone 2C10
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SNX12 |
| Gene Alias | MGC118982|MGC118983 |
| Gene Description | sorting nexin 12 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | RMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SNX12 (AAH20559, 53 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 29934 |
| Clone Number | 2C10 |
| Iso type | IgG2a Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SNX12.