ALG5 polyclonal antibody (A01)
  • ALG5 polyclonal antibody (A01)

ALG5 polyclonal antibody (A01)

Ref: AB-H00029880-A01
ALG5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ALG5.
Información adicional
Size 50 uL
Gene Name ALG5
Gene Alias RP11-421P11.2|bA421P11.2
Gene Description asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ALG5 (NP_037470, 232 a.a. ~ 324 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 29880

Enviar un mensaje


ALG5 polyclonal antibody (A01)

ALG5 polyclonal antibody (A01)