View larger
Mouse polyclonal antibody raised against a partial recombinant ALG5.
AB-H00029880-A01
New product
ALG5 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | ALG5 |
| Gene Alias | RP11-421P11.2|bA421P11.2 |
| Gene Description | asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | RDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ALG5 (NP_037470, 232 a.a. ~ 324 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 29880 |
More info
Mouse polyclonal antibody raised against a partial recombinant ALG5.