MOCS3 polyclonal antibody (A01) Ver mas grande

MOCS3 polyclonal antibody (A01)

AB-H00027304-A01

Producto nuevo

MOCS3 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name MOCS3
Gene Alias MGC9252|UBA4|dJ914P20.3
Gene Description molybdenum cofactor synthesis 3
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MOCS3 (AAH15939, 1 a.a. ~ 460 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 27304

Más información

Mouse polyclonal antibody raised against a full-length recombinant MOCS3.

Consulta sobre un producto

MOCS3 polyclonal antibody (A01)

MOCS3 polyclonal antibody (A01)