View larger
Mouse polyclonal antibody raised against a full-length recombinant MOCS3.
AB-H00027304-A01
New product
MOCS3 polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | MOCS3 |
| Gene Alias | MGC9252|UBA4|dJ914P20.3 |
| Gene Description | molybdenum cofactor synthesis 3 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | MOCS3 (AAH15939, 1 a.a. ~ 460 a.a) full-length recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 27304 |
More info
Mouse polyclonal antibody raised against a full-length recombinant MOCS3.