ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)
  • ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)

ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00027033-B02P
ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZBTB32 protein.
Información adicional
Size 50 ug
Gene Name ZBTB32
Gene Alias FAXF|FAZF|Rog|TZFP|ZNF538
Gene Description zinc finger and BTB domain containing 32
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZBTB32 (AAH17700.1, 1 a.a. ~ 302 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 27033

Enviar un mensaje


ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)

ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)