Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)
Abnova
ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)
Ref: AB-H00027033-B02P
ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)
Contacte-nos
Información del producto
Mouse polyclonal antibody raised against a full-length human ZBTB32 protein.
Información adicional
Size
50 ug
Gene Name
ZBTB32
Gene Alias
FAXF|FAZF|Rog|TZFP|ZNF538
Gene Description
zinc finger and BTB domain containing 32
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr,IF
Immunogen Prot. Seq
MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARALGVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQKPEQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPVGQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWAEAPWL
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ZBTB32 (AAH17700.1, 1 a.a. ~ 302 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
27033
Enviar uma mensagem
ZBTB32 purified MaxPab mouse polyclonal antibody (B02P)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*