Ver mas grande
AIPL1 monoclonal antibody (M23), clone 3A3
AB-H00023746-M23
Producto nuevo
AIPL1 monoclonal antibody (M23), clone 3A3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | AIPL1 |
| Gene Alias | AIPL2|LCA4 |
| Gene Description | aryl hydrocarbon receptor interacting protein-like 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | AIPL1 (NP_055151.3, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23746 |
| Clone Number | 3A3 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant AIPL1.