View larger
Mouse monoclonal antibody raised against a partial recombinant AIPL1.
AB-H00023746-M23
New product
AIPL1 monoclonal antibody (M23), clone 3A3
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | AIPL1 |
| Gene Alias | AIPL2|LCA4 |
| Gene Description | aryl hydrocarbon receptor interacting protein-like 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP,S-ELISA,ELISA |
| Immunogen Prot. Seq | MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | AIPL1 (NP_055151.3, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 23746 |
| Clone Number | 3A3 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant AIPL1.