Ver mas grande
HEY1 MaxPab mouse polyclonal antibody (B02)
AB-H00023462-B02
Producto nuevo
HEY1 MaxPab mouse polyclonal antibody (B02)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | HEY1 |
| Gene Alias | BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1 |
| Gene Description | hairy/enhancer-of-split related with YRPW motif 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLL |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | HEY1 (NP_036390.3, 1 a.a. ~ 304 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 23462 |
Más información
Mouse polyclonal antibody raised against a full-length human HEY1 protein.