HEY1 MaxPab mouse polyclonal antibody (B02) View larger

Mouse polyclonal antibody raised against a full-length human HEY1 protein.

AB-H00023462-B02

New product

HEY1 MaxPab mouse polyclonal antibody (B02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 uL
Gene Name HEY1
Gene Alias BHLHb31|CHF2|HERP2|HESR1|HRT-1|MGC1274|OAF1
Gene Description hairy/enhancer-of-split related with YRPW motif 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKRAHPEYSSSDSELDETIEVEKESADENGNLSSALGSMSPTTSSQILARKRRRGIIEKRRRDRINNSLSELRRLVPSAFEKQGSAKLEKAEILQMTVDHLKMLHTAGGKGYFDAHALAMDYRSLGFRECLAEVARYLSIIEGLDASDPLRVRLVSHLNNYASQREAASGAHAGLGHIPWGTVFGHHPHIAHPLLLPQNGHGNAGTTASPTEPHHQGRLGSAHPEAPALRAPPSGSLGPVLPVVTSASKLSPPLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen HEY1 (NP_036390.3, 1 a.a. ~ 304 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23462

More info

Mouse polyclonal antibody raised against a full-length human HEY1 protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human HEY1 protein.

Mouse polyclonal antibody raised against a full-length human HEY1 protein.