MAPRE1 MaxPab mouse polyclonal antibody (B01)
  • MAPRE1 MaxPab mouse polyclonal antibody (B01)

MAPRE1 MaxPab mouse polyclonal antibody (B01)

Ref: AB-H00022919-B01
MAPRE1 MaxPab mouse polyclonal antibody (B01)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.
Información adicional
Size 50 uL
Gene Name MAPRE1
Gene Alias EB1|MGC117374|MGC129946
Gene Description microtubule-associated protein, RP/EB family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPRE1 (NP_036457, 1 a.a. ~ 268 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 22919

Enviar un mensaje


MAPRE1 MaxPab mouse polyclonal antibody (B01)

MAPRE1 MaxPab mouse polyclonal antibody (B01)