View larger
Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.
AB-H00022919-B01
New product
MAPRE1 MaxPab mouse polyclonal antibody (B01)
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | MAPRE1 |
| Gene Alias | EB1|MGC117374|MGC129946 |
| Gene Description | microtubule-associated protein, RP/EB family, member 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Tr |
| Immunogen Prot. Seq | MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVI |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | MAPRE1 (NP_036457, 1 a.a. ~ 268 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 22919 |
More info
Mouse polyclonal antibody raised against a full-length human MAPRE1 protein.