ZNF277 MaxPab rabbit polyclonal antibody (D01)
  • ZNF277 MaxPab rabbit polyclonal antibody (D01)

ZNF277 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011179-D01
ZNF277 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ZNF277 protein.
Información adicional
Size 100 uL
Gene Name ZNF277
Gene Alias NRIF4|ZNF277P
Gene Description zinc finger protein 277
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZNF277 (ENSP00000355043, 1 a.a. ~ 438 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11179

Enviar un mensaje


ZNF277 MaxPab rabbit polyclonal antibody (D01)

ZNF277 MaxPab rabbit polyclonal antibody (D01)