Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZNF277 MaxPab rabbit polyclonal antibody (D01)
Abnova
ZNF277 MaxPab rabbit polyclonal antibody (D01)
Ref: AB-H00011179-D01
ZNF277 MaxPab rabbit polyclonal antibody (D01)
Contacte-nos
Información del producto
Rabbit polyclonal antibody raised against a full-length human ZNF277 protein.
Información adicional
Size
100 uL
Gene Name
ZNF277
Gene Alias
NRIF4|ZNF277P
Gene Description
zinc finger protein 277
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Tr
Immunogen Prot. Seq
MQEDRDGSCSTVGGVGYGDSKDCILEPLSLPESPGGTTTLEGSPSVPCIFCEEHFPVAEQDKLLKHMIIEHKIVIADVKLVADFQRYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVILNHMAREHAFNIGLPDNIVNCNEFLCTLQKKLDNLQCLYCEKTFRDKNTLKDHMRKKQHRKINPKNREYDRFYVINYL
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ZNF277 (ENSP00000355043, 1 a.a. ~ 438 a.a) full-length human protein.
Storage Buffer
No additive
Gene ID
11179
Enviar uma mensagem
ZNF277 MaxPab rabbit polyclonal antibody (D01)
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*