RAB32 polyclonal antibody (A01) Ver mas grande

RAB32 polyclonal antibody (A01)

AB-H00010981-A01

Producto nuevo

RAB32 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name RAB32
Gene Alias -
Gene Description RAB32, member RAS oncogene family
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB32 (NP_006825, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10981

Más información

Mouse polyclonal antibody raised against a partial recombinant RAB32.

Consulta sobre un producto

RAB32 polyclonal antibody (A01)

RAB32 polyclonal antibody (A01)