AB-H00010981-A01
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Size | 50 uL |
Gene Name | RAB32 |
Gene Alias | - |
Gene Description | RAB32, member RAS oncogene family |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ce,WB-Re,ELISA |
Immunogen Prot. Seq | IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | RAB32 (NP_006825, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. |
Storage Buffer | 50 % glycerol |
Gene ID | 10981 |