Ver mas grande
PPARGC1A monoclonal antibody (M02), clone 3B5
AB-H00010891-M02
Producto nuevo
PPARGC1A monoclonal antibody (M02), clone 3B5
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PPARGC1A |
| Gene Alias | LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1 |
| Gene Description | peroxisome proliferator-activated receptor gamma, coactivator 1 alpha |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10891 |
| Clone Number | 3B5 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.