AB-H00010891-M02
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 100 ug |
Gene Name | PPARGC1A |
Gene Alias | LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1 |
Gene Description | peroxisome proliferator-activated receptor gamma, coactivator 1 alpha |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | S-ELISA,ELISA,IF |
Immunogen Prot. Seq | TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR |
Antigen species Target species | Human |
Quality control testing | Antibody Reactive Against Recombinant Protein. |
Immunogen | PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 10891 |
Clone Number | 3B5 |
Iso type | IgG2a Kappa |