Ver mas grande
SLU7 polyclonal antibody (A01)
AB-H00010569-A01
Producto nuevo
SLU7 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | SLU7 |
| Gene Alias | 9G8|MGC9280|hSlu7 |
| Gene Description | SLU7 splicing factor homolog (S. cerevisiae) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSVITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQTEKDHNSEDEDEDKYADDIDMPGQNFD |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLU7 (AAH10634.1, 1 a.a. ~ 586 a.a) full-length recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 10569 |
Más información
Mouse polyclonal antibody raised against a full-length recombinant SLU7.