SLU7 polyclonal antibody (A01)
  • SLU7 polyclonal antibody (A01)

SLU7 polyclonal antibody (A01)

Ref: AB-H00010569-A01
SLU7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant SLU7.
Información adicional
Size 50 uL
Gene Name SLU7
Gene Alias 9G8|MGC9280|hSlu7
Gene Description SLU7 splicing factor homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSATVVDAVNAAPLSGSKEMSLEEPKKMTREDWRKKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKHQRPQPEKQKQFSSSGEWYKRGVKENSVITKYRKGACENCGAMTHKKKDCFERPRRVGAKFTGTNIAPDEHVQPQLMFDYDGKRDRWNGYNPEEHMKIVEEYAKVDLAKRTLKAQKLQEELASGKLVEQANSPKHQWGEEEPNSQTEKDHNSEDEDEDKYADDIDMPGQNFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLU7 (AAH10634.1, 1 a.a. ~ 586 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10569

Enviar uma mensagem


SLU7 polyclonal antibody (A01)

SLU7 polyclonal antibody (A01)