Ver mas grande
PRDX4 monoclonal antibody (M01), clone 2C12
AB-H00010549-M01
Producto nuevo
PRDX4 monoclonal antibody (M01), clone 2C12
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | PRDX4 |
| Gene Alias | AOE37-2|PRX-4 |
| Gene Description | peroxiredoxin 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA |
| Immunogen Prot. Seq | CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PRDX4 (AAH03609, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10549 |
| Clone Number | 2C12 |
| Iso type | IgG3 Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant PRDX4.