PRDX4 monoclonal antibody (M01), clone 2C12
  • PRDX4 monoclonal antibody (M01), clone 2C12

PRDX4 monoclonal antibody (M01), clone 2C12

Ref: AB-H00010549-M01
PRDX4 monoclonal antibody (M01), clone 2C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRDX4.
Información adicional
Size 100 ug
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDX4 (AAH03609, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10549
Clone Number 2C12
Iso type IgG3 Kappa

Enviar un mensaje


PRDX4 monoclonal antibody (M01), clone 2C12

PRDX4 monoclonal antibody (M01), clone 2C12