PRDX4 monoclonal antibody (M01), clone 2C12 View larger

Mouse monoclonal antibody raised against a partial recombinant PRDX4.

AB-H00010549-M01

New product

PRDX4 monoclonal antibody (M01), clone 2C12

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name PRDX4
Gene Alias AOE37-2|PRX-4
Gene Description peroxiredoxin 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq CHFFAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRDX4 (AAH03609, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10549
Clone Number 2C12
Iso type IgG3 Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant PRDX4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant PRDX4.

Mouse monoclonal antibody raised against a partial recombinant PRDX4.