PSMD14 monoclonal antibody (M01), clone 4A10-E8
  • PSMD14 monoclonal antibody (M01), clone 4A10-E8

PSMD14 monoclonal antibody (M01), clone 4A10-E8

Ref: AB-H00010213-M01
PSMD14 monoclonal antibody (M01), clone 4A10-E8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant PSMD14.
Información adicional
Size 100 ug
Gene Name PSMD14
Gene Alias PAD1|POH1|rpn11
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 14
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA,IF
Immunogen Prot. Seq MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PSMD14 (AAH09524.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10213
Clone Number 4A10-E8
Iso type IgG1 Kappa

Enviar un mensaje


PSMD14 monoclonal antibody (M01), clone 4A10-E8

PSMD14 monoclonal antibody (M01), clone 4A10-E8