View larger
Mouse monoclonal antibody raised against a full length recombinant PSMD14.
AB-H00010213-M01
New product
PSMD14 monoclonal antibody (M01), clone 4A10-E8
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | PSMD14 |
| Gene Alias | PAD1|POH1|rpn11 |
| Gene Description | proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | MLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PSMD14 (AAH09524.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10213 |
| Clone Number | 4A10-E8 |
| Iso type | IgG1 Kappa |
More info
Mouse monoclonal antibody raised against a full length recombinant PSMD14.