Ver mas grande
SH2D3C monoclonal antibody (M03), clone 3D6
AB-H00010044-M03
Producto nuevo
SH2D3C monoclonal antibody (M03), clone 3D6
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SH2D3C |
| Gene Alias | CHAT|FLJ39664|NSP3|PRO34088 |
| Gene Description | SH2 domain containing 3C |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10044 |
| Clone Number | 3D6 |
| Iso type | IgG1 kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SH2D3C.