View larger
Mouse monoclonal antibody raised against a partial recombinant SH2D3C.
AB-H00010044-M03
New product
SH2D3C monoclonal antibody (M03), clone 3D6
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | SH2D3C |
| Gene Alias | CHAT|FLJ39664|NSP3|PRO34088 |
| Gene Description | SH2 domain containing 3C |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SH2D3C (NP_005480, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 10044 |
| Clone Number | 3D6 |
| Iso type | IgG1 kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant SH2D3C.