Ver mas grande
GINS1 purified MaxPab rabbit polyclonal antibody (D01P)
AB-H00009837-D01P
Producto nuevo
GINS1 purified MaxPab rabbit polyclonal antibody (D01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | GINS1 |
| Gene Alias | KIAA0186|PSF1 |
| Gene Description | GINS complex subunit 1 (Psf1 homolog) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr |
| Immunogen Prot. Seq | MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | GINS1 (NP_066545.2, 1 a.a. ~ 196 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9837 |
Más información
Rabbit polyclonal antibody raised against a full-length human GINS1 protein.