GINS1 purified MaxPab rabbit polyclonal antibody (D01P)
  • GINS1 purified MaxPab rabbit polyclonal antibody (D01P)

GINS1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00009837-D01P
GINS1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GINS1 protein.
Información adicional
Size 100 ug
Gene Name GINS1
Gene Alias KIAA0186|PSF1
Gene Description GINS complex subunit 1 (Psf1 homolog)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GINS1 (NP_066545.2, 1 a.a. ~ 196 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9837

Enviar uma mensagem


GINS1 purified MaxPab rabbit polyclonal antibody (D01P)

GINS1 purified MaxPab rabbit polyclonal antibody (D01P)