Ver mas grande
DOCK4 monoclonal antibody (M01), clone 3E7
AB-H00009732-M01
Producto nuevo
DOCK4 monoclonal antibody (M01), clone 3E7
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | DOCK4 |
| Gene Alias | FLJ34238|KIAA0716|MGC134911|MGC134912 |
| Gene Description | dedicator of cytokinesis 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF |
| Immunogen Prot. Seq | NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9732 |
| Clone Number | 3E7 |
| Iso type | IgG2b Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant DOCK4.