DOCK4 monoclonal antibody (M01), clone 3E7 View larger

Mouse monoclonal antibody raised against a partial recombinant DOCK4.

AB-H00009732-M01

New product

DOCK4 monoclonal antibody (M01), clone 3E7

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name DOCK4
Gene Alias FLJ34238|KIAA0716|MGC134911|MGC134912
Gene Description dedicator of cytokinesis 4
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq NQVNEQSAPLPVPVPVPVPSYGGEEPVRKESKTPPPYSVYERTLRRPVPLPHSLSIPVTSEPPALPPKPLAARSSHLENGARRTDPGPRPRPLPRKVSQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DOCK4 (NP_055520, 1867 a.a. ~ 1966 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9732
Clone Number 3E7
Iso type IgG2b Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant DOCK4.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant DOCK4.

Mouse monoclonal antibody raised against a partial recombinant DOCK4.