Ver mas grande
HS2ST1 polyclonal antibody (A01)
AB-H00009653-A01
Producto nuevo
HS2ST1 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | HS2ST1 |
| Gene Alias | FLJ11317|KIAA0448|MGC131986|dJ604K5.2 |
| Gene Description | heparan sulfate 2-O-sulfotransferase 1 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ti,WB-Re,ELISA |
| Immunogen Prot. Seq | SWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | HS2ST1 (NP_036394, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 9653 |
Más información
Mouse polyclonal antibody raised against a partial recombinant HS2ST1.