HS2ST1 polyclonal antibody (A01)
  • HS2ST1 polyclonal antibody (A01)

HS2ST1 polyclonal antibody (A01)

Ref: AB-H00009653-A01
HS2ST1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HS2ST1.
Información adicional
Size 50 uL
Gene Name HS2ST1
Gene Alias FLJ11317|KIAA0448|MGC131986|dJ604K5.2
Gene Description heparan sulfate 2-O-sulfotransferase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq SWKEMKPGFYHGHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HS2ST1 (NP_036394, 130 a.a. ~ 229 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9653

Enviar uma mensagem


HS2ST1 polyclonal antibody (A01)

HS2ST1 polyclonal antibody (A01)