PPM1F polyclonal antibody (A01)
  • PPM1F polyclonal antibody (A01)

PPM1F polyclonal antibody (A01)

Ref: AB-H00009647-A01
PPM1F polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PPM1F.
Información adicional
Size 50 uL
Gene Name PPM1F
Gene Alias CaMKPase|FEM-2|KIAA0015|POPX2|hFEM-2
Gene Description protein phosphatase 1F (PP2C domain containing)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 9647

Enviar un mensaje


PPM1F polyclonal antibody (A01)

PPM1F polyclonal antibody (A01)