View larger
Mouse polyclonal antibody raised against a partial recombinant PPM1F.
AB-H00009647-A01
New product
PPM1F polyclonal antibody (A01)
Ao comprar este produto pode ganhar até 2 pontos de fidelização. Seu carrinho totalizará 2 pontos de fidelização que podem ser convertidos num vale de desconto de 8.00EUR.
Data sheet
| Size | 50 uL |
| Gene Name | PPM1F |
| Gene Alias | CaMKPase|FEM-2|KIAA0015|POPX2|hFEM-2 |
| Gene Description | protein phosphatase 1F (PP2C domain containing) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,WB-Re,ELISA |
| Immunogen Prot. Seq | MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRKAPPPLAAALAHEAVSQLLQTDLSEFRKLPR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | PPM1F (NP_055449, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 9647 |
More info
Mouse polyclonal antibody raised against a partial recombinant PPM1F.