ENTPD4 monoclonal antibody (M01), clone 4H7
  • ENTPD4 monoclonal antibody (M01), clone 4H7

ENTPD4 monoclonal antibody (M01), clone 4H7

Ref: AB-H00009583-M01
ENTPD4 monoclonal antibody (M01), clone 4H7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENTPD4.
Información adicional
Size 100 ug
Gene Name ENTPD4
Gene Alias KIAA0392|LALP70|LAP70|LYSAL1|NTPDase-4|UDPase
Gene Description ectonucleoside triphosphate diphosphohydrolase 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENTPD4 (NP_004892.1, 371 a.a. ~ 469 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9583
Clone Number 4H7
Iso type IgG2b Kappa

Enviar un mensaje


ENTPD4 monoclonal antibody (M01), clone 4H7

ENTPD4 monoclonal antibody (M01), clone 4H7