View larger
Mouse monoclonal antibody raised against a partial recombinant ENTPD4.
AB-H00009583-M01
New product
ENTPD4 monoclonal antibody (M01), clone 4H7
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | ENTPD4 |
| Gene Alias | KIAA0392|LALP70|LAP70|LYSAL1|NTPDase-4|UDPase |
| Gene Description | ectonucleoside triphosphate diphosphohydrolase 4 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILR |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | ENTPD4 (NP_004892.1, 371 a.a. ~ 469 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9583 |
| Clone Number | 4H7 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant ENTPD4.