LY86 monoclonal antibody (M01), clone 1H3
  • LY86 monoclonal antibody (M01), clone 1H3

LY86 monoclonal antibody (M01), clone 1H3

Ref: AB-H00009450-M01
LY86 monoclonal antibody (M01), clone 1H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LY86.
Información adicional
Size 100 ug
Gene Name LY86
Gene Alias MD-1|MMD-1|dJ80N2.1
Gene Description lymphocyte antigen 86
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LY86 (AAH38846, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9450
Clone Number 1H3
Iso type IgG2a Kappa

Enviar un mensaje


LY86 monoclonal antibody (M01), clone 1H3

LY86 monoclonal antibody (M01), clone 1H3