Ver mas grande
LY86 monoclonal antibody (M01), clone 1H3
AB-H00009450-M01
Producto nuevo
LY86 monoclonal antibody (M01), clone 1H3
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | LY86 |
| Gene Alias | MD-1|MMD-1|dJ80N2.1 |
| Gene Description | lymphocyte antigen 86 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,S-ELISA,ELISA |
| Immunogen Prot. Seq | AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | LY86 (AAH38846, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 9450 |
| Clone Number | 1H3 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant LY86.