LY86 monoclonal antibody (M01), clone 1H3 View larger

Mouse monoclonal antibody raised against a partial recombinant LY86.

AB-H00009450-M01

New product

LY86 monoclonal antibody (M01), clone 1H3

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name LY86
Gene Alias MD-1|MMD-1|dJ80N2.1
Gene Description lymphocyte antigen 86
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,S-ELISA,ELISA
Immunogen Prot. Seq AWPTHVVCSDSGLEVLYQSCDPLQDFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LY86 (AAH38846, 26 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9450
Clone Number 1H3
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant LY86.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant LY86.

Mouse monoclonal antibody raised against a partial recombinant LY86.