Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
XPR1 monoclonal antibody (M06), clone 2G8
Abnova
XPR1 monoclonal antibody (M06), clone 2G8
Ref: AB-H00009213-M06
XPR1 monoclonal antibody (M06), clone 2G8
Contáctenos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant XPR1.
Información adicional
Size
100 ug
Gene Name
XPR1
Gene Alias
FLJ90308|SYG1|X3
Gene Description
xenotropic and polytropic retrovirus receptor
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq
PLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEAN
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
XPR1 (NP_004727.2, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
9213
Clone Number
2G8
Iso type
IgG1 Kappa
Enviar un mensaje
XPR1 monoclonal antibody (M06), clone 2G8
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*