XPR1 monoclonal antibody (M06), clone 2G8
  • XPR1 monoclonal antibody (M06), clone 2G8

XPR1 monoclonal antibody (M06), clone 2G8

Ref: AB-H00009213-M06
XPR1 monoclonal antibody (M06), clone 2G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant XPR1.
Información adicional
Size 100 ug
Gene Name XPR1
Gene Alias FLJ90308|SYG1|X3
Gene Description xenotropic and polytropic retrovirus receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PLEVFRRFVWNFFRLENEHLNNCGEFRAVRDISVAPLNADDQTLLEQMMDQDDGVRNRQKNRSWKYNQSISLRRPRLASQSKARDTKVLIEDTDDEAN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XPR1 (NP_004727.2, 598 a.a. ~ 695 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 9213
Clone Number 2G8
Iso type IgG1 Kappa

Enviar uma mensagem


XPR1 monoclonal antibody (M06), clone 2G8

XPR1 monoclonal antibody (M06), clone 2G8